PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g111290.1
Common NameMTR_7g111290, MtrDRAFT_AC157894g4v2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB
Protein Properties Length: 382aa    MW: 42774.4 Da    PI: 6.7236
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g111290.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Medtr7g111290.1 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding43.47.8e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+  +++++++lG++ W+ Ia+ ++ gRt++++k+ w++
  Medtr7g111290.1  67 RGAFSEQEENSIIELHALLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466893.37E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002492.7E-161461IPR001005SANT/Myb domain
CDDcd001672.28E-121761No hitNo description
Gene3DG3DSA:1.10.10.606.7E-2565117IPR009057Homeodomain-like
SMARTSM007172.6E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129419.2466116IPR017930Myb domain
PfamPF002494.1E-1367110IPR001005SANT/Myb domain
CDDcd001676.34E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SEQEENSIIE LHALLGNRWS QIAAQLPGRT DNEIKNLWNS SLKKKLKQKG  120
IDPNTHQPFS ENNDNDTPNI QIQKTSVGSN EVKNLFDDTP NPNSIPMDNC NYPLEINSKI  180
NNSVNCFIPC DNMVGLGGGS YLNFQQLNYG INNMTLSPPN SNSNTSLCFI PSTSGSTSTC  240
SQMMSELNSS TMFHSMYTNH PSNSISSGEV DGIQNWEFGA SKSSNGSSIN NYLDHQVVED  300
IKWSDYINST PFFLGNNNTF QQTTTSTHSS IYEVKQEMGG FINTNESIQS SSSTWHPHFE  360
ADIYSNKDLQ RFSLAFGQTL N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1578940.0AC157894.3 Medicago truncatula chromosome 7 clone mth2-85d15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003626126.10.0myb transcription factor
TrEMBLQ2HRU10.0Q2HRU1_MEDTR; Homeodomain-related
STRINGGLYMA03G38660.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-80myb domain protein 61
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]